PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_B820523A7.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 465aa    MW: 47044.8 Da    PI: 6.7978
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_B820523A7.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH34.63.4e-11252300555
                            HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                    HLH   5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                            h+++Er RR+ri +++  L+el+P+a  ++    +Ka++L + ++Y+k Lq
  Traes_5BL_B820523A7.2 252 HSIAERLRRERIAERMKALQELVPNA--NKWLQTDKASMLDEIIDYVKFLQ 300
                            99***********************7..48888*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000834.02E-13245304No hitNo description
SuperFamilySSF474599.03E-16245308IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088816.399247299IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.108.0E-15251311IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.7E-8252300IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.7E-12253305IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048767Biological Processroot hair elongation
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MQPTTREMQA MAAAGQISLD DLRSGHAGVN NGGAGGVHDD FLDQMFGSLP PSAWHDLAAG  60
TKPEDGAQAD GMQQQLFGGP YDDSMMLASR LRQHQISGGP GGGAASAKQM VLRQLADLRQ  120
GHHNNMLLQG MGRSPSIGGG GGEGGLLLPL TLGNGGSGGD VQALLKAAAN SAGGDAGVFG  180
GFAGSLQQQQ HFQPHPQQQT APMPSQTFGG VGGAPGGGAQ PQQQAGGGGG GGAPAPPRQR  240
VRARRGQATD PHSIAERLRR ERIAERMKAL QELVPNANKW LQTDKASMLD EIIDYVKFLQ  300
LQVKTSMPTH TQVLSMSRLG GAAAVAPLVA DMSSEGRGGA AGGAADGSDG LTVTEQQVAK  360
LMEEDMGAAM QYLQGKGLCL MPVSLASAIS SATCQLRPPA AAAGGPFTAA QHMSAAMRMS  420
VGDGGVPASP SMSVLTAQSA MANGGACAND GEGSHPKDAA SVSKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256261RLRRER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057848e-57AP005784.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0014G10.
GenBankAP0149658e-57AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126178e-57CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238169.11e-165PREDICTED: transcription factor bHLH66 isoform X2
SwissprotQ9ZUG96e-72BH066_ARATH; Transcription factor bHLH66
TrEMBLW5FH160.0W5FH16_WHEAT; Uncharacterized protein
STRINGBRADI4G30350.11e-171(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141937118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24260.17e-42LJRHL1-like 1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]